Oldguykitchen.com belongs to AUTOMATTIC - Automattic, Inc, US. Check the list of other websites hosted by AUTOMATTIC - Automattic, Inc, US.
In terms of rank-to-traffic ratio, oldguykitchen.com has 1,626 unique users per day, viewing 3,285 pages. The rank based value of oldguykitchen.com is 2,333 USD. Every user makes 2.16 pageviews on average.
Oldguykitchen.com boasts a link base consisting of 216 referring domains and 393 external backlinks, as revealed by the data obtained from web network scanning.
Oldguykitchen.com top-level domain belongs to .COM domain zone. Check other webpages in .COM zone.
According the last verification test in March 15, 2024, oldguykitchen.com has an expired SSL certificate issued by Let's Encrypt (expired on April 21, 2024). Click button “Update” SSL Information at the Safety Information section. Check the list of websites using SSL by Let's Encrypt.
Based on data from Google Safe Browsing and Symantec oldguykitchen.com is a fairly safe domain.
Based on Mobile-Friendly test by Google oldguykitchen.com is poorly optimized for mobile phones and tablets. Remember that optimizing your website design for mobile devices ensures that all of your web pages perform well on all devices, page loading speed can also be accelerated.
Domain | tls.automattic.com |
Issuer Organization | Let's Encrypt |
Issuer | R3 |
Algorithm | RSA-SHA256 |
Valid form | 01/22/2024 |
Expiration | 04/21/2024 |
Signed | Certificate is not self signed |
Additional Domains |
anitajacob.co.uk beaucameron.com biblecenter.family.blog billjeffreyfmdh710.law.blog billmcgrathharvey00.law.blog bos-baseball.com emusicales.music.blog fatherhoodandfinances.com holland-today.com hopechristianchildandfamilyservices.com immobilebrasilbahia.com ipcsllc3.com karenshafer.com katezamarchi.com kcsonic.com liangshunkun.code.blog massimilianomartino.art meadowsweet.blog miraculousthreads.code.blog missdoublevay.com musicbybeta.music.blog nannawinkel.com ninamflores.com nolcos2022.com octorarasoccer.com oldguykitchen.com tls.automattic.com www.anitajacob.co.uk www.beaucameron.com www.billjeffreyfmdh710.law.blog www.cashpchl042.finance.blog www.cricaction.law.blog www.emusicales.music.blog www.fatherhoodandfinances.com www.holland-today.com www.hopechristianchildandfamilyservices.com www.immobilebrasilbahia.com www.ipcsllc3.com www.karenshafer.com www.katezamarchi.com www.liangshunkun.code.blog www.linemanplacement.com www.madsfrostgame.design www.massimilianomartino.art www.meadowsweet.blog www.miraculousthreads.code.blog www.musicbybeta.music.blog www.nolcos2022.com www.octorarasoccer.com |
Alexa Rank shows how popular oldguykitchen.com is in comparison with other sites. The most popular site has Alexa Rank equals 1. If oldguykitchen.com has Alexa Rank equals 100,000, then it is in TOP 100,000 popular sites in the world. The rank is calculated using a combination of average daily visitors to oldguykitchen.com and pageviews on oldguykitchen.com over the past 3 months.
ASN ID: 2635
ASN Title: AUTOMATTIC - Automattic, Inc, USLast Update: 03/04/2024
#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/whois_tou.html
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/whois_reporting/index.html
#
# Copyright 1997-2018, American Registry for Internet Numbers, Ltd.
#
ASNumber: 2635
ASName: AUTOMATTIC
ASHandle: AS2635
RegDate: 2012-10-01
Updated: 2012-10-01
Ref: https://rdap.arin.net/registry/autnum/2635
OrgName: Automattic, Inc
OrgId: AUTOM-93
Address: 60 29th Street #343
City: San Francisco
StateProv: CA
PostalCode: 94110
Country: US
RegDate: 2011-10-05
Updated: 2018-06-04
Ref: https://rdap.arin.net/registry/entity/AUTOM-93
OrgNOCHandle: NOC12276-ARIN
OrgNOCName: NOC
OrgNOCPhone: +1-877-273-8550
OrgNOCEmail: ipadmin@automattic.com
OrgNOCRef: https://rdap.arin.net/registry/entity/NOC12276-ARIN
OrgTechHandle: NOC12276-ARIN
OrgTechName: NOC
OrgTechPhone: +1-877-273-8550
OrgTechEmail: ipadmin@automattic.com
OrgTechRef: https://rdap.arin.net/registry/entity/NOC12276-ARIN
OrgAbuseHandle: ABUSE3970-ARIN
OrgAbuseName: Abuse
OrgAbusePhone: +1-877-273-8550
OrgAbuseEmail: abuse@automattic.com
OrgAbuseRef: https://rdap.arin.net/registry/entity/ABUSE3970-ARIN
#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/whois_tou.html
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/whois_reporting/index.html
#
# Copyright 1997-2018, American Registry for Internet Numbers, Ltd.
#
Domain Name: OLDGUYKITCHEN.COM
Registry Domain ID: 2345044639_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.sawbuck.com
Registrar URL: http://www.wordpress.com
Updated Date: 2021-11-20T18:32:19Z
Creation Date: 2018-12-20T15:15:36Z
Registry Expiry Date: 2022-12-20T15:15:36Z
Registrar: Automattic Inc.
Registrar IANA ID: 1531
Registrar Abuse Contact Email: domainabuse@automattic.com
Registrar Abuse Contact Phone: +1 877 273-3049
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.WORDPRESS.COM
Name Server: NS2.WORDPRESS.COM
Name Server: NS3.WORDPRESS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2022-04-29T17:12:18Z
Host | A Record | TTL |
---|
Host | MX Record | Priority | TTL |
---|
Host | NS Record | TTL |
---|
Host | TXT Record | TTL |
---|